PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462905084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HSF
Protein Properties Length: 221aa    MW: 25341.7 Da    PI: 7.9757
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462905084genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind86.73.2e-271282272
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekks 72
                  Fl+k+++++ d++++ ++sw + gnsf+v+d++ fa  +Lp++Fkh+nf+SFvRQLn+YgF+k++ +++++
     462905084 12 FLTKTFDLVADPATDGVVSWGRAGNSFIVWDPHVFAAVLLPRFFKHNNFSSFVRQLNTYGFRKIDPDRRRR 82
                  9***************************************************************9998764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004153.3E-358130IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.103.0E-29883IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467858.71E-261079IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000565.7E-191235IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.9E-241299IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.7E-195062IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS0043405175IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.7E-196375IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MEGLHEVGPP PFLTKTFDLV ADPATDGVVS WGRAGNSFIV WDPHVFAAVL LPRFFKHNNF  60
SSFVRQLNTY GFRKIDPDRR RRPPSYLPAS QQQQALGTYL EVGHFGGLDE EIDRLKRDKN  120
ILLAEVVKLR QEQQSTKADM QAMEERLQHA ESKQLQMMGF LARAMQNPDF FHQLLQHQDR  180
RRELEDAFSK KRRRPIDIVP FAAGAGAAAA ETRRQGEEEL D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A9e-2210751883Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179193RRRELEDAFSKKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126118e-83CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985605.11e-122PREDICTED: heat stress transcription factor A-2d-like
SwissprotQ8H7Y61e-120HFA2D_ORYSJ; Heat stress transcription factor A-2d
TrEMBLK4AJ431e-122K4AJ43_SETIT; Uncharacterized protein
STRINGSi038907m1e-122(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30837231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.11e-75heat shock transcription factor A6B